Protein Info for ECD_03184 in Escherichia coli BL21

Annotation: general secretory pathway component, cryptic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 242 to 265 (24 residues), see Phobius details TIGR01709: type II secretion system protein L" amino acids 6 to 384 (379 residues), 373.9 bits, see alignment E=5.1e-116 PF05134: T2SSL" amino acids 6 to 232 (227 residues), 272.9 bits, see alignment E=1.9e-85 PF12693: GspL_C" amino acids 240 to 384 (145 residues), 138.8 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 100% identical to GSPL_ECOLI: Putative type II secretion system protein L (gspL) from Escherichia coli (strain K12)

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 100% identity to eco:b3333)

MetaCyc: 100% identical to type II secretion system protein GspL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ECD_03184 general secretory pathway component, cryptic (Escherichia coli BL21)
MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG
LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLGRY
LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ
FPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSG
KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFHFY
FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE
LTQSWLPMEKTEKDPVSGVWTVRNSGK