Protein Info for ECD_03097 in Escherichia coli BL21

Annotation: l-arginine-responsive arginine metabolism regulon transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01316: Arg_repressor
  • amino acids 6 to 74 (69 residues), 87.9 bits, E=2.9e-29
• TIGR01529: arginine repressor
  • amino acids 9 to 152 (144 residues), 163.5 bits, E=1.6e-52
• PF02863: Arg_repressor_C
  • amino acids 82 to 148 (67 residues), 77 bits, E=8e-26

Best Hits

Swiss-Prot: 99% identical to ARGR_SHIDS: Arginine repressor (argR) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 99% identity to eco:b3237)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Protein Sequence (156 amino acids)

>ECD_03097 l-arginine-responsive arginine metabolism regulon transcriptional regulator (Escherichia coli BL21)
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRN
AKMEMVYCLLAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEG
ILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL