Protein Info for ECD_03076 in Escherichia coli BL21

Annotation: putative Fe-S oxidoreductase, Radical SAM superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR01212: radical SAM protein, TIGR01212 family" amino acids 6 to 301 (296 residues), 472.7 bits, see alignment E=2.2e-146 PF04055: Radical_SAM" amino acids 43 to 202 (160 residues), 69.6 bits, see alignment E=3.9e-23 PF16199: Radical_SAM_C" amino acids 208 to 291 (84 residues), 69.5 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 100% identical to YHCC_ECOLI: Protein YhcC (yhcC) from Escherichia coli (strain K12)

KEGG orthology group: K07139, (no description) (inferred from 100% identity to eco:b3211)

Predicted SEED Role

"COG1242: Predicted Fe-S oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ECD_03076 putative Fe-S oxidoreductase, Radical SAM superfamily protein (Escherichia coli BL21)
MQLQKLVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFADEAQQH
RSIAEQLAHQANLVNRAKRYLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPD
CVPDAVLDLLCEYKDQGYEVWLELGLQTAHDKTLHRINRGHDFACYQRTTQLARQRGLKV
CSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGSIMAKAWEAGRLNGIELED
YTLTAGEMIRHTPPEVIYHRISASARRPTLLAPLWCENRWTGMVELDRYLNEHGVQGSAL
GRPWLPPTE