Protein Info for ECD_03049 in Escherichia coli BL21

Annotation: EamA family inner membrane putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 56 (18 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 205 (17 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 142 (136 residues), 101.2 bits, see alignment E=2.9e-33 amino acids 159 to 291 (133 residues), 64.1 bits, see alignment E=8.2e-22

Best Hits

Swiss-Prot: 100% identical to YHBE_SHIFL: Uncharacterized inner membrane transporter YhbE (yhbE) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b3184)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ECD_03049 EamA family inner membrane putative transporter (Escherichia coli BL21)
MKQQAGIGILLALTTAICWGALPIAMKQVLEVMEPPTIVFYRFLMASIGLGAILAVKKRL
PPLRVFRKPRWLILLAVATAGLFGNFILFSSSLQYLSPTASQVIGQLSPVGMMVASVFIL
KEKMRSTQVVGALMLLSGLVMFFNTSLVEIFTKLTDYTWGVIFGVGAATVWVSYGVAQKV
LLRRLASPQILFLLYTLCTIALFPLAKPGVIAQLSHWQLACLIFCGLNTLVGYGALAEAM
ARWQAAQVSAIITLTPLFTLFFSDLLSLAWPDFFARPMLNLLGYLGAFVVVAGAMYSAIG
HRIWGGLRKHTTVVSQPRAGE