Protein Info for ECD_03039 in Escherichia coli BL21

Annotation: putative EptAB family phosphoethanolamine transferase, inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 15 to 31 (17 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF00884: Sulfatase" amino acids 224 to 467 (244 residues), 191.4 bits, see alignment E=1.2e-60

Best Hits

Swiss-Prot: 100% identical to YHBX_ECOLI: Putative transferase YhbX (yhbX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3173)

Predicted SEED Role

"Outer-membrane protein yhbX precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>ECD_03039 putative EptAB family phosphoethanolamine transferase, inner membrane protein (Escherichia coli BL21)
MTVFNKFARSFKSHWLLYLCVIVFGITNLVASSGAHMVQRLLFFVLTILVVKRISSLPLR
LLVAAPFVLLTAADMSISLYSWCTFGTTFNDGFAISVLQSDPDEVVKMLGMYIPYLCAFA
FLSLLFLAVIIKYDVSLPTKKVTGILLLIVISGSLFSACQFAYKDAKNKKAFSPYILASR
FATYTPFFNLNYFALAAKEHQRLLSIANTVPYFQLSVRDTGIDTYVLIVGESVRVDNMSL
YGYTRSTTPQVEAQRKQIKLFNQAISGAPYTALSVPLSLTADSVLSHDIHNYPDNIINMA
NQAGFQTFWLSSQSAFRQNGTAVTSIAMRAMETVYVRGFDELLLPHLSQALQQNTQQKKL
IVLHLNGSHEPACSAYPQSSAVFQPQDDQDACYDNSIHYTDSLLGQVFELLKDRRASVMY
FADHGLERDPTKKNVYFHGGREASQQAYHVPMFIWYSPVLGDGVDRTTENNIFSTAYNNY
LINAWMGVTKPEQPQTLEEVIAHYKGDSRVVDANHDVFDYVMLRKEFTEDKQGNPTPEGQ
G