Protein Info for ECD_03008 in Escherichia coli BL21
Annotation: galactosamine-6-phosphate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to AGAI_ECOLI: Putative deaminase AgaI (agaI) from Escherichia coli (strain K12)
KEGG orthology group: K02080, galactosamine-6-phosphate isomerase [EC: 5.3.1.-] (inferred from 100% identity to eco:b3141)Predicted SEED Role
"Galactosamine-6-phosphate isomerase (galactosamine-6-phosphate deaminase) (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)
KEGG Metabolic Maps
- Biosynthesis of ansamycins
- Galactose metabolism
- Inositol phosphate metabolism
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.3.1.-
Use Curated BLAST to search for 5.3.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (251 amino acids)
>ECD_03008 galactosamine-6-phosphate isomerase (Escherichia coli BL21) MERGTASGGASLLKEFHPVQTLQQVENYTALSERASEYLLAVIRSKPDAVICLATGATPL LTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTCETFLQQHIVQPLGLREDQLIS FRSEEINETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDARTQ QHEMLKTAGRPVTRGITLGLKDILNAREVLLLVTGEGKQDATDRFLTAKVSTAIPASFLW LHSNFICLINT