Protein Info for ECD_03008 in Escherichia coli BL21

Annotation: galactosamine-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01182: Glucosamine_iso" amino acids 28 to 239 (212 residues), 73.2 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 100% identical to AGAI_ECOLI: Putative deaminase AgaI (agaI) from Escherichia coli (strain K12)

KEGG orthology group: K02080, galactosamine-6-phosphate isomerase [EC: 5.3.1.-] (inferred from 100% identity to eco:b3141)

Predicted SEED Role

"Galactosamine-6-phosphate isomerase (galactosamine-6-phosphate deaminase) (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>ECD_03008 galactosamine-6-phosphate isomerase (Escherichia coli BL21)
MERGTASGGASLLKEFHPVQTLQQVENYTALSERASEYLLAVIRSKPDAVICLATGATPL
LTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTCETFLQQHIVQPLGLREDQLIS
FRSEEINETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDARTQ
QHEMLKTAGRPVTRGITLGLKDILNAREVLLLVTGEGKQDATDRFLTAKVSTAIPASFLW
LHSNFICLINT