Protein Info for ECD_02875 in Escherichia coli BL21

Annotation: putative hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01738: DLH" amino acids 43 to 253 (211 residues), 164.1 bits, see alignment E=7.5e-52 PF02129: Peptidase_S15" amino acids 118 to 169 (52 residues), 27.1 bits, see alignment E=6.7e-10 PF08840: BAAT_C" amino acids 122 to 183 (62 residues), 23.4 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 97% identity to ecq:ECED1_3650)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ECD_02875 putative hydrolase (Escherichia coli BL21)
MTALALFDLLKPNYALATQVEFTDLEIVAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAV
VVVHENRGLNPYIEDVARRVAKAGYIALAPDGLSSVGGYPGNDDKGRELQQQVDPTKLMN
DFFAAIEFMQRYPQATGKVGITGFCYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKI
EAPLLLHFAELDTRINEGWPAYEAALKANNKVYEAYIYPGVNHGFHNDSTPRYDKSAADL
SWQRTLKWFDKYLS