Protein Info for ECD_02857 in Escherichia coli BL21

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01626: conserved hypothetical protein YtfJ-family, TIGR01626" amino acids 1 to 184 (184 residues), 211.9 bits, see alignment E=3.1e-67 PF09695: YtfJ_HI0045" amino acids 25 to 182 (158 residues), 199.1 bits, see alignment E=2e-63

Best Hits

Swiss-Prot: 54% identical to YTFJ_ECOLI: Uncharacterized protein YtfJ (ytfJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecr:ECIAI1_3130)

Predicted SEED Role

"Transcriptional regulator, YtfJ-family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>ECD_02857 hypothetical protein (Escherichia coli BL21)
MSSRLIIALIIMLLAPGVQAHNFVTGKTVTPVYIQEGGELLLNSDDEIHYQKWNSTQLAG
KVRIIQYIAGRKSAKKKNSLLIKAVEAANFPQDRFQPTTIVNTDDAIFGTGYFVVGKIEK
NKRRYPWAQFVIDGNGQGRVAWRLPEQSSTILVLNKAGQIQWAKDGSLTPEEVDHVIALA
QKLINE