Protein Info for ECD_02779 in Escherichia coli BL21

Annotation: putative Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03652: RuvX
  • amino acids 4 to 136 (133 residues), 158 bits, E=8.7e-51
• TIGR00250: putative transcription antitermination factor YqgF
  • amino acids 6 to 135 (130 residues), 209.2 bits, E=9.4e-67

Best Hits

Swiss-Prot: 99% identical to YQGF_ECODH: Putative pre-16S rRNA nuclease (yqgF) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 99% identity to eco:b2949)

MetaCyc: 99% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Protein Sequence (138 amino acids)

>ECD_02779 putative Holliday junction resolvase (Escherichia coli BL21)
MSGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVG
LPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK
VDSASAVIILESYFEQEY