Protein Info for ECD_02773 in Escherichia coli BL21

Annotation: D-galactose transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 15 to 43 (29 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 386 to 412 (27 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 7 to 447 (441 residues), 506.8 bits, see alignment E=3.2e-156 PF06609: TRI12" amino acids 10 to 201 (192 residues), 36 bits, see alignment E=4.6e-13 PF00083: Sugar_tr" amino acids 18 to 450 (433 residues), 484.6 bits, see alignment E=4.9e-149 PF07690: MFS_1" amino acids 23 to 284 (262 residues), 109.3 bits, see alignment E=3.1e-35 amino acids 264 to 446 (183 residues), 42.6 bits, see alignment E=5.8e-15

Best Hits

Swiss-Prot: 100% identical to GALP_ECOL6: Galactose-proton symporter (galP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08137, MFS transporter, SP family, galactose:H+ symporter (inferred from 100% identity to eco:b2943)

MetaCyc: 100% identical to galactose:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN0-7077; TRANS-RXN-21

Predicted SEED Role

"Arabinose-proton symporter" in subsystem L-Arabinose utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ECD_02773 D-galactose transporter (Escherichia coli BL21)
MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSS
MMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVG
VASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIP
AILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWA
LFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTN
VLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIV
GFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWV
YAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD