Protein Info for ECD_02755 in Escherichia coli BL21

Annotation: mechanosensitive channel protein, small conductance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 96 to 125 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 16 to 64 (49 residues), 49.7 bits, see alignment 5.7e-17 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 35.4 bits, see alignment 1.6e-12 PF00924: MS_channel_2nd" amino acids 114 to 180 (67 residues), 77.5 bits, see alignment E=1.3e-25 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 76.8 bits, see alignment E=2.9e-25

Best Hits

Swiss-Prot: 100% identical to MSCS_SHIFL: Small-conductance mechanosensitive channel (mscS) from Shigella flexneri

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to eco:b2924)

MetaCyc: 100% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>ECD_02755 mechanosensitive channel protein, small conductance (Escherichia coli BL21)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA