Protein Info for ECD_02730 in Escherichia coli BL21

Annotation: iron-sulfur cluster repair protein, plumbagin resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR03317: folate-binding protein YgfZ" amino acids 187 to 251 (65 residues), 88.1 bits, see alignment E=1.4e-29 PF21130: YgfZ_barrel" amino acids 244 to 311 (68 residues), 120.9 bits, see alignment E=9.5e-40

Best Hits

Swiss-Prot: 100% identical to YGFZ_ECO55: tRNA-modifying protein YgfZ (ygfZ) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K06980, (no description) (inferred from 100% identity to eco:b2898)

Predicted SEED Role

"Folate-dependent protein for Fe/S cluster synthesis/repair in oxidative stress"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>ECD_02730 iron-sulfur cluster repair protein, plumbagin resistance (Escherichia coli BL21)
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLA
AHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGV
AGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGE
AELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKF
RGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDM
EPDSIFRVRDDANTLHIEPLPYSLEE