Protein Info for ECD_02706 in Escherichia coli BL21

Annotation: D-stereospecific phenylhydantoinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR02033: dihydropyrimidinase" amino acids 3 to 453 (451 residues), 675.3 bits, see alignment E=2.3e-207 PF01979: Amidohydro_1" amino acids 50 to 434 (385 residues), 69.2 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 100% identical to PHYDA_ECO8A: D-phenylhydantoinase (hyuA) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K01464, dihydropyrimidinase [EC: 3.5.2.2] (inferred from 100% identity to eco:b2873)

MetaCyc: 100% identical to phenylhydantoinase (Escherichia coli K-12 substr. MG1655)
3.5.2.-

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>ECD_02706 D-stereospecific phenylhydantoinase (Escherichia coli BL21)
MRVLIKNGTVVNADGQAKQDLLIESGIVRQLGNNISPQLPYEEIDATGCYVFPGGVDVHT
HFNIDVGIARSCDDFFTGTRAAACGGTTTIIDHMGFGPNGCRLRHQLEVYRGYAAHKAVI
DYSFHGVIQHINHAILDEIPMMVEEGLSSFKLYLTYQYKLNDDEVLQALRRLHESGALTT
VHPENDAAIASKRAEFIAAGLTAPRYHALSRPLECEAEAIARMINLAQIAGNAPLYIVHL
SNGLGLDYLRLARANHQPVWVETCPQYLLLDERSYDTEDGMKFILSPPLRNVREQDKLWC
GISDGAIDVVATDHCTFSMAQRLQISKGDFSRCPNGLPGVENRMQLLFSSGVMTGRITPE
RFVELTSAMPARLFGLWPQKGLLAPGSDGDVVIIDPRQSQQIQHRHLHDNADYSPWEGFT
CQGAIVRTLSRGETIFCDGTFTGKAGRGRFLRRKPFVPPVL