Protein Info for ECD_02688 in Escherichia coli BL21

Annotation: Asp/Glu_racemase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR00035: aspartate racemase" amino acids 1 to 229 (229 residues), 208 bits, see alignment E=7.7e-66 PF01177: Asp_Glu_race" amino acids 7 to 223 (217 residues), 145.4 bits, see alignment E=1.1e-46

Best Hits

Swiss-Prot: 100% identical to YGEA_ECOBD: L-aspartate/glutamate-specific racemase (ygeA) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: None (inferred from 100% identity to eco:b2840)

MetaCyc: 100% identical to amino acid racemase YgeA (Escherichia coli K-12 substr. MG1655)
5.1.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ECD_02688 Asp/Glu_racemase family protein (Escherichia coli BL21)
MKTIGLLGGMSWESTIPYYRLINEGIKQRLGGLHSAQVLLHSVDFHEIEECQRRGEWDKT
GDILAEAALGLQRAGAEGIVLCTNTMHKVADAIESRCTLPFLHIADATGRAITGAGMTRV
ALLGTRYTMEQDFYRGRLTEQFSINCLIPEADERAKINQIIFEELCLGQFTEASRAYYAQ
VIARLAEQGAQGVIFGCTEIGLLVPEERSVLPVFDTAAIHAEDAVAFMLS