Protein Info for ECD_02663 in Escherichia coli BL21

Annotation: tRNA threonylcarbamoyladenosine dehydratase; sulfur acceptor for CsdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 237 to 257 (21 residues), see Phobius details PF00899: ThiF" amino acids 19 to 262 (244 residues), 132.7 bits, see alignment E=6.3e-43

Best Hits

Swiss-Prot: 100% identical to TCDA_ECOLI: tRNA threonylcarbamoyladenosine dehydratase (tcdA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2812)

MetaCyc: 100% identical to tRNA threonylcarbamoyladenosine dehydratase (Escherichia coli K-12 substr. MG1655)
RXN0-7115

Predicted SEED Role

"CsdL (EC-YgdL) protein of the HesA/MoeB/ThiF family, part of the CsdA-E-L sulfur transfer pathway"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>ECD_02663 tRNA threonylcarbamoyladenosine dehydratase; sulfur acceptor for CsdA (Escherichia coli BL21)
MSVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLI
DMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSV
GYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAK
LRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSDGTVCAMKATAEGPKRMDCASGFGA
ATMVTATFGFVAVSHALKKMMAKAARQG