Protein Info for ECD_02643 in Escherichia coli BL21

Annotation: Ssb-binding protein, misidentified as ExoIX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details PF02739: 5_3_exonuc_N" amino acids 35 to 173 (139 residues), 100.3 bits, see alignment E=1e-32 PF01367: 5_3_exonuc" amino acids 190 to 279 (90 residues), 96 bits, see alignment E=1.6e-31

Best Hits

Swiss-Prot: 100% identical to XNI_SHIBS: Flap endonuclease Xni (xni) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K01146, protein Xni (inferred from 98% identity to ecg:E2348C_3065)

Predicted SEED Role

"DNA polymerase I (EC 2.7.7.7)" in subsystem DNA-replication or DNA Repair Base Excision (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ECD_02643 Ssb-binding protein, misidentified as ExoIX (Escherichia coli BL21)
MRGLFPISHPAVACSGIECYPYRLIFKGVIVAVHLLIVDALNLIRRIHAVQGSPCVETCQ
HALDQLIMHSQPTHAVAVFDDENRSSGWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQ
RGVPCWSTSGNEADDLAATLAVKVTQAGHQATIVSTDKGYCQLLSPTLRIRDYFQKRWLD
APFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSATQLLVEFQSLEGIYENLDAV
AEKWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLVR