Protein Info for ECD_02599 in Escherichia coli BL21

Annotation: DUF3561 family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 52 to 78 (27 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details PF12084: DUF3561" amino acids 1 to 107 (107 residues), 179.6 bits, see alignment E=7.3e-58

Best Hits

Swiss-Prot: 100% identical to YGBE_ECOLI: Inner membrane protein YgbE (ygbE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2749)

Predicted SEED Role

"Putative cytochrome oxidase subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>ECD_02599 DUF3561 family inner membrane protein (Escherichia coli BL21)
MRNSHNITLTNNDSLTEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTLFFFIYTWPF
FLALMPVAVVVGIALHSLMDGKLRYSIVFTLVTVGIMFGALFMWLLG