Protein Info for ECD_02558 in Escherichia coli BL21

Annotation: D-arabinose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01380: SIS" amino acids 38 to 170 (133 residues), 104.9 bits, see alignment E=2.8e-34 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 43 to 311 (269 residues), 448.3 bits, see alignment E=5.2e-139 PF00571: CBS" amino acids 202 to 256 (55 residues), 19.7 bits, see alignment E=8.6e-08 amino acids 279 to 317 (39 residues), 25.5 bits, see alignment 1.4e-09

Best Hits

Swiss-Prot: 100% identical to GUTQ_ECOLI: Arabinose 5-phosphate isomerase GutQ (gutQ) from Escherichia coli (strain K12)

KEGG orthology group: K02467, GutQ protein (inferred from 100% identity to eco:b2708)

MetaCyc: 100% identical to D-arabinose 5-phosphate isomerase GutQ (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.13

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ECD_02558 D-arabinose 5-phosphate isomerase (Escherichia coli BL21)
MSEALLNAGRQTLMLELQEASRLPERLGDDFVRAANIILHCEGKVVVSGIGKSGHIGKKI
AATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKELDLIIPRLEDKSIALL
AMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGDALAMAVMQARGFNEE
DFARSHPAGALGARLLNKVHHLMRRDDAIPQVALTASVMDAMLELSRTGLGLVAVCDAQQ
QVQGVFTDGDLRRWLVGGGALTTPVNEAMTVGGTTLQSQSRAIDAKEILMKRKITAAPVV
DENGKLTGAINLQDFYQAGII