Protein Info for ECD_02496 in Escherichia coli BL21

Annotation: tRNA m(1)G37 methyltransferase, SAM-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 1 to 234 (234 residues), 374.5 bits, see alignment E=7.9e-117 PF01746: tRNA_m1G_MT" amino acids 23 to 221 (199 residues), 243.5 bits, see alignment E=7.8e-77

Best Hits

Swiss-Prot: 100% identical to TRMD_ECOBW: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 100% identity to eco:b2607)

MetaCyc: 100% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>ECD_02496 tRNA m(1)G37 methyltransferase, SAM-dependent (Escherichia coli BL21)
MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGM
LMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDE
RVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPH
YTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEF
KTEHAQQQHKHDGMA