Protein Info for ECD_02471 in Escherichia coli BL21

Annotation: putative DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 61.4 bits, see alignment E=6.5e-21 PF03466: LysR_substrate" amino acids 87 to 289 (203 residues), 154.9 bits, see alignment E=1.9e-49

Best Hits

Swiss-Prot: 100% identical to YFIE_ECOLI: Uncharacterized HTH-type transcriptional regulator YfiE (yfiE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2577)

Predicted SEED Role

"LysR family transcriptional regulator YfiE" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ECD_02471 putative DNA-binding transcriptional regulator (Escherichia coli BL21)
MDLRRFITLKTVVEEGSFLRASQKLCCTQSTVTFHIQQLEQEFSVQLFEKIGRRMCLTRE
GKKLLPHIYELTRVMDTLREAAKKESDPDGELRVVSGETLLSYRMPQVLQRFRQRAPKVR
LSLQSLNCYVIRDALLNDEADVGVFYRVGNDDALNRRELGEQSLVLVASPQIADVDFTEP
GRHNACSFIINEPQCVFRQIFESTLRQRRITVENTIELISIESIKRCVAANIGVSYLPRF
AVAKELECGELIELPFGEQSQTITAMCAHHAGKAVSPAMHTFIQCVEESFVAG