Protein Info for ECD_02380 in Escherichia coli BL21

Annotation: hydrogenase 4, Fe-S subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF12838: Fer4_7" amino acids 39 to 87 (49 residues), 38.2 bits, see alignment E=2.5e-13 PF13187: Fer4_9" amino acids 39 to 88 (50 residues), 30.2 bits, see alignment E=5.7e-11 PF00037: Fer4" amino acids 72 to 89 (18 residues), 32.4 bits, see alignment (E = 8.5e-12)

Best Hits

Swiss-Prot: 96% identical to HYFH_ECOLI: Hydrogenase-4 component H (hyfH) from Escherichia coli (strain K12)

KEGG orthology group: K12143, hydrogenase-4 component H (inferred from 100% identity to ebd:ECBD_1200)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>ECD_02380 hydrogenase 4, Fe-S subunit (Escherichia coli BL21)
MLKLLKTIMRAGTATVKYPFAPLEVSPGFRGKPDLMPSQCIACGACACPANALTIQTDDQ
QNSRTWQLYLRRCIYCGRCEEVCPTRAIQLTNNFELTVTNKADLYTRATFHLQRCSRCER
PFAQQKTVALATELLAQQQNAPQNREMLWAQASVCPECKQRATLLNDDTDVPLVAKEQL