Protein Info for ECD_02180 in Escherichia coli BL21

Annotation: undecaprenyl phosphate-L-Ara4FN transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 236 to 259 (24 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 10 to 175 (166 residues), 36.9 bits, see alignment E=5.1e-13 PF10111: Glyco_tranf_2_2" amino acids 11 to 103 (93 residues), 32.6 bits, see alignment E=9.5e-12 PF00535: Glycos_transf_2" amino acids 11 to 172 (162 residues), 122.7 bits, see alignment E=2.4e-39

Best Hits

Swiss-Prot: 100% identical to ARNC_ECOSE: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) from Escherichia coli (strain SE11)

KEGG orthology group: K10012, undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC: 2.7.8.30] (inferred from 100% identity to eco:b2254)

MetaCyc: 100% identical to undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (Escherichia coli K-12 substr. MG1655)
RXN0-3521 [EC: 2.4.2.53]

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.- or 2.4.2.53 or 2.7.8.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ECD_02180 undecaprenyl phosphate-L-Ara4FN transferase (Escherichia coli BL21)
MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE
ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG
YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER
STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG
SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT
DVRARPRYFVQQVIRPSSKENE