Protein Info for ECD_02131 in Escherichia coli BL21

Annotation: ferredoxin-type protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details TIGR02163: ferredoxin-type protein, NapH/MauN family" amino acids 24 to 278 (255 residues), 388 bits, see alignment E=1.1e-120 PF12801: Fer4_5" amino acids 83 to 126 (44 residues), 46.5 bits, see alignment 7.1e-16 amino acids 178 to 211 (34 residues), 23.7 bits, see alignment 9.6e-09 PF13237: Fer4_10" amino acids 222 to 270 (49 residues), 33.7 bits, see alignment 7e-12

Best Hits

Swiss-Prot: 100% identical to NAPH_ECOLI: Ferredoxin-type protein NapH (napH) from Escherichia coli (strain K12)

KEGG orthology group: K02574, ferredoxin-type protein NapH (inferred from 100% identity to eco:b2204)

MetaCyc: 100% identical to ferredoxin-type protein NapH (Escherichia coli K-12 substr. MG1655)
RXN-18584 [EC: 7.1.1.8]

Predicted SEED Role

"Polyferredoxin NapH (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>ECD_02131 ferredoxin-type protein (Escherichia coli BL21)
MANRKRDAGREALEKKGWWRSHRWLVLRRLCQFFVLGMFLSGPWFGVWILHGNYSSSLLF
DTVPLTDPLMTLQSLASGHLPATVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANW
LRRRFDLNQSATIPRHIRYVLLVVILVGSALTGTLIWEWINPVSLMGRSLVMGFGSGALL
ILALFLFDLLVVEHGWCGHICPVGALYGVLGSKGVITVAATDRQKCNRCMDCFHVCPEPH
VLRAPVLDEQSPVQVTSRDCMTCGRCVDVCSEDVFTITTRWSSGAKS