Protein Info for ECD_02121 in Escherichia coli BL21

Annotation: heme lyase, CcmH subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 100 to 120 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details PF03918: CcmH" amino acids 7 to 143 (137 residues), 169.1 bits, see alignment E=5.4e-54

Best Hits

Swiss-Prot: 99% identical to CCMH_ECOLI: Cytochrome c-type biogenesis protein CcmH (ccmH) from Escherichia coli (strain K12)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 99% identity to eco:b2194)

MetaCyc: 99% identical to holocytochrome c synthase CcmH component (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL / Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>ECD_02121 heme lyase, CcmH subunit (Escherichia coli BL21)
MRFLLGVLMLMISGSALATIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIAT
DLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTPLTVLLWVLPVVAIGIGGWVIY
ARSRRRVRVVPEAFPEQSVQEGKRAGYIVYLPGIVVALIVAGVSYYQTGNYQQVKIWQQA
TAQAPALLDRALDPKTDPLNEEEMSRLALGMRTQLQKNPGDIEGWIMLGRVGMALGNASI
ATDAYATAYRLDPKNSDAALGYAEALTRSSDPNDNRLGGELLRQLVRSDHSNIRVLSMYA
FNAFEQQRFGEAVAAWEMMLKLLPANDTRRAVIERSIAQAMQHLSPQESK