Protein Info for ECD_02120 in Escherichia coli BL21

Annotation: response regulator in two-component regulatory system with NarQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00072: Response_reg" amino acids 9 to 121 (113 residues), 107.3 bits, see alignment E=9.8e-35 PF00196: GerE" amino acids 152 to 207 (56 residues), 85.8 bits, see alignment E=2.3e-28 PF13412: HTH_24" amino acids 156 to 194 (39 residues), 23.9 bits, see alignment 4.8e-09 PF08281: Sigma70_r4_2" amino acids 167 to 196 (30 residues), 28.4 bits, see alignment 2e-10

Best Hits

Swiss-Prot: 100% identical to NARP_ECOLI: Nitrate/nitrite response regulator protein NarP (narP) from Escherichia coli (strain K12)

KEGG orthology group: K07685, two-component system, NarL family, nitrate/nitrite response regulator NarP (inferred from 100% identity to eco:b2193)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>ECD_02120 response regulator in two-component regulatory system with NarQ (Escherichia coli BL21)
MPEATPFQVMIVDDHPLMRRGVRQLLELDPGFEVVAEAGDGASAIDLANRLDIDVILLDL
NMKGMSGLDTLNALRRDGVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAI
RAGAKGSKVFSERVNQYLREREMFGAEEDPFSVLTERELDVLHELAQGLSNKQIASVLNI
SEQTVKVHIRNLLRKLNVRSRVAATILFLQQRGAQ