Protein Info for ECD_02111 in Escherichia coli BL21

Annotation: uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF13989: YejG" amino acids 4 to 109 (106 residues), 169.4 bits, see alignment E=1.4e-54

Best Hits

Swiss-Prot: 99% identical to YEJG_ECOLI: Uncharacterized protein YejG (yejG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ebr:ECB_02111)

Predicted SEED Role

"FIG00896318: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>ECD_02111 uncharacterized protein (Escherichia coli BL21)
MTSLQLSIVHRLPQNYRWSAGFAGSKVEPIPQNGPCGDNSLVALKLLSPDCDNAWSVMYK
LSQALSDIEVPCSVLECEGEPCLFVNRQDEFAATCRLKNFGVAIAEPFSNYNPF