Protein Info for ECD_02076 in Escherichia coli BL21

Annotation: dihydropyrimidine dehydrogenase, NADH-dependent, subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 6 to 319 (314 residues), 200.4 bits, see alignment E=1.7e-63 PF01180: DHO_dh" amino acids 6 to 304 (299 residues), 131.3 bits, see alignment E=1.1e-41 PF01207: Dus" amino acids 91 to 195 (105 residues), 30.4 bits, see alignment E=5.6e-11 PF14697: Fer4_21" amino acids 338 to 395 (58 residues), 58.1 bits, see alignment E=1.9e-19 PF12838: Fer4_7" amino acids 343 to 392 (50 residues), 30.4 bits, see alignment 1.1e-10 PF00037: Fer4" amino acids 374 to 394 (21 residues), 21.3 bits, see alignment (E = 4.5e-08)

Best Hits

Swiss-Prot: 100% identical to PREA_ECO57: NAD-dependent dihydropyrimidine dehydrogenase subunit PreA (preA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2147)

MetaCyc: 100% identical to dihydropyrimidine dehydrogenase (NAD+) subunit PreA (Escherichia coli K-12 substr. MG1655)
Dihydrouracil dehydrogenase (NAD(+)). [EC: 1.3.1.1]; 1.3.1.1 [EC: 1.3.1.1]

Predicted SEED Role

"Dihydropyrimidine dehydrogenase [NADP+] (EC 1.3.1.2)" in subsystem Pyrimidine utilization (EC 1.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.1 or 1.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ECD_02076 dihydropyrimidine dehydrogenase, NADH-dependent, subunit C (Escherichia coli BL21)
MLTKDLSITFCGVKFPNPFCLSSSPVGNCYEMCAKAYDTGWGGVVFKTIGFFIANEVSPR
FDHLVKEDTGFIGFKNMEQIAEHPLEENLAALRRLKEDYPDKVLIASIMGENEQQWEELA
RLVQEAGADMIECNFSCPQMTSHAMGSDVGQSPELVEKYCRAVKRGSTLPMLAKMTPNIG
DMCEVALAAKRGGADGIAAINTVKSITNIDLNQKIGMPIVNGKSSISGYSGKAVKPIALR
FIQQMRTHPELRDFPISGIGGIETWEDAAEFLLLGAATLQVTTGIMQYGYRIVEDMASGL
SHYLADQGFDSLQEMVGLANNNIVPAEDLDRSYIVYPRINLDKCVGCGRCYISCYDGGHQ
AMEWSEKTRTPHCNTEKCVGCLLCGHVCPVGCIELGEVKFKKGEKEHPVTL