Protein Info for ECD_02068 in Escherichia coli BL21

Annotation: putative outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 11 to 451 (441 residues), 265.5 bits, see alignment E=4.5e-83 PF02321: OEP" amino acids 46 to 242 (197 residues), 156.3 bits, see alignment E=3.8e-50 amino acids 268 to 450 (183 residues), 167.2 bits, see alignment E=1.7e-53

Best Hits

Swiss-Prot: 99% identical to MDTQ_SHIFL: Putative multidrug resistance outer membrane protein MdtQ (mdtQ) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to eci:UTI89_C2412)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>ECD_02068 putative outer membrane protein (Escherichia coli BL21)
MHETRQALSQQTPAAQVDTALPTALKNGWPDSQWWLEYHDNQLTSLINNALQNAPDMQVA
EQRIQLAEAQAKAVATQDGPQIDFSADMERQKMSAEGLMGPFALNDPAAGTTGPWYTNGT
FGLTAGWHLDIWGKNRAEVTARLGTVKARAAEREQTRQLLAGSVARLYWEWQTQAALNTV
LQQIEKEQNTIIATDRQLYQNGITSSVEGVETDINASKTRQQLNDVAGKMKIIEARLSAL
TNNQTKSLKLKPVALPKVASQLPDELGYSLLARRADLQAAHWYVESSLSTIDAAKAAFYP
DINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGRLNANLDIAKAESNLSIASY
NKAVVEAVNDVARAASQVQTLAEKNQHQAQIERDALRVVGLAQARFNAGIIAGSRVSEAR
IPALRERANGLLLQGQWLDASIQLTGALGGGYKR