Protein Info for ECD_02026 in Escherichia coli BL21

Annotation: nucleoside transporter, low affinity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 70 to 86 (17 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 324 (27 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details TIGR00889: nucleoside transporter" amino acids 1 to 418 (418 residues), 653.8 bits, see alignment E=6.4e-201 PF03825: Nuc_H_symport" amino acids 1 to 405 (405 residues), 610.3 bits, see alignment E=2.5e-187 PF12832: MFS_1_like" amino acids 6 to 362 (357 residues), 115.9 bits, see alignment E=3.5e-37 PF07690: MFS_1" amino acids 7 to 353 (347 residues), 65.8 bits, see alignment E=5.2e-22

Best Hits

Swiss-Prot: 100% identical to YEGT_ECOLI: Putative nucleoside transporter YegT (yegT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2098)

Predicted SEED Role

"Putative nucleoside transporter YegT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ECD_02026 nucleoside transporter, low affinity (Escherichia coli BL21)
MKTTAKLSFMMFVEWFIWGAWFVPLWLWLSKSGFSAGEIGWSYACTAIAAILSPILVGSI
TDRFFSAQKVLAVLMFAGALLMYFAAQQTTFAGFFPLLLAYSLTYMPTIALTNSIAFANV
PDVERDFPRIRVMGTIGWIASGLACGFLPQMLGYADISPTNIPLLITAGSSALLGVFAFF
LPDTPPKSTGKMDIKVMLGLDALILLRDKNFLVFFFCSFLFAMPLAFYYIFANGYLTEVG
MKNATGWMTLGQFSEIFFMLALPFFTKRFGIKKVLLLGLVTAAIRYGFFIYGSADEYFTY
ALLFLGILLHGVSYDFYYVTAYIYVDKKAPVHMRTAAQGLITLCCQGFGSLLGYRLGGVM
MERMFAYQEPVNGLTFNWSGMWTFGAVMIAIIAVLFMIFFRESDNEITAIKVDDRDIALT
QGEVK