Protein Info for ECD_01914 in Escherichia coli BL21

Annotation: exodeoxyribonuclease I; exonuclease I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF00929: RNase_T" amino acids 13 to 188 (176 residues), 110.9 bits, see alignment E=1.4e-35 PF08411: ExoI_SH3" amino acids 212 to 353 (142 residues), 195.2 bits, see alignment E=8.4e-62 PF26016: ExoI_C" amino acids 361 to 474 (114 residues), 126.4 bits, see alignment E=1e-40

Best Hits

Swiss-Prot: 99% identical to EX1_ECOLI: Exodeoxyribonuclease I (sbcB) from Escherichia coli (strain K12)

KEGG orthology group: K01141, exodeoxyribonuclease I [EC: 3.1.11.1] (inferred from 99% identity to eco:b2011)

MetaCyc: 99% identical to exodeoxyribonuclease I (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Exodeoxyribonuclease I (EC 3.1.11.1)" in subsystem DNA Repair Base Excision (EC 3.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>ECD_01914 exodeoxyribonuclease I; exonuclease I (Escherichia coli BL21)
MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDNEFNVIGEPEVFYCKPADDYLPQ
PGAVLITGITPQEARAKGENEAAFAARIHSLFTVPKTCILGYNNVRFDDEVTRNVFYRNF
YDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNA
HDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWR
GNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNAAVPVKL
VHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFAEAEPFTPS
DNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLD
YAEQQRWLEHRRQVFTPEFLQGYADELQMLAQQYADDKEKVALLKALWQYAQEIV