Protein Info for ECD_01910 in Escherichia coli BL21

Annotation: UPF0265 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF04363: DUF496" amino acids 8 to 100 (93 residues), 154.6 bits, see alignment E=2.9e-50

Best Hits

Swiss-Prot: 100% identical to YEEX_ECO57: UPF0265 protein YeeX (yeeX) from Escherichia coli O157:H7

KEGG orthology group: K09802, hypothetical protein (inferred from 100% identity to eco:b2007)

Predicted SEED Role

"UPF0265 protein YeeX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>ECD_01910 UPF0265 family protein (Escherichia coli BL21)
METTKPSFQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEA
IQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKAMGEMKNGEAK