Protein Info for ECD_01875 in Escherichia coli BL21

Annotation: tyrosine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 28 to 28 (1 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 1 to 390 (390 residues), 490.7 bits, see alignment E=3.5e-151 PF01490: Aa_trans" amino acids 6 to 213 (208 residues), 37.5 bits, see alignment E=1.2e-13 TIGR00837: aromatic amino acid transport protein" amino acids 7 to 384 (378 residues), 490.3 bits, see alignment E=2.4e-151

Best Hits

Swiss-Prot: 100% identical to TYRP_ECOLI: Tyrosine-specific transport protein (tyrP) from Escherichia coli (strain K12)

KEGG orthology group: K03834, tyrosine-specific transport protein (inferred from 100% identity to eco:b1907)

Predicted SEED Role

"Tyrosine-specific transport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>ECD_01875 tyrosine transporter (Escherichia coli BL21)
MKNRTLGSVFIVAGTTIGAGMLAMPLAAAGVGFSVTLILLIGLWALMCYTALLLLEVYQH
VPADTGLGTLAKRYLGRYGQWLTGFSMMFLMYALTAAYISGAGELLASSISDWTGISMSA
TAGVLLFTFVAGGVVCVGTSLVDLFNRFLFSAKIIFLVVMLVLLLPHIHKVNLLTLPLQQ
GLALSAIPVIFTSFGFHGSVPSIVSYMDGNVRKLRWVFITGSAIPLVAYIFWQVATLGSI
DSTTFMGLLANHAGLNGLLQALREMVASPHVELAVHLFADLALATSFLGVALGLFDYLAD
LFQRSNTVGGRLQTGAITFLPPLAFALFYPRGFVMALGYAGVALAVLALIIPSLLTWQSR
KHNPQAGYRVKGGRPALVVVFLCGIAVIGVQFLIAAGLLPEVG