Protein Info for ECD_01856 in Escherichia coli BL21

Annotation: methyl-accepting protein IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 187 to 209 (23 residues), see Phobius details PF02203: TarH" amino acids 1 to 167 (167 residues), 142 bits, see alignment E=2.9e-45 PF00672: HAMP" amino acids 209 to 260 (52 residues), 37.7 bits, see alignment 3.2e-13 PF00015: MCPsignal" amino acids 323 to 480 (158 residues), 188.8 bits, see alignment E=1.1e-59

Best Hits

Swiss-Prot: 100% identical to MCP4_ECOLI: Methyl-accepting chemotaxis protein IV (tap) from Escherichia coli (strain K12)

KEGG orthology group: K05877, methyl-accepting chemotaxis protein IV, peptide sensor receptor (inferred from 100% identity to eco:b1885)

Predicted SEED Role

"Methyl-accepting chemotaxis protein IV (dipeptide chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>ECD_01856 methyl-accepting protein IV (Escherichia coli BL21)
MFNRIRISTTLFLILILCGILQIGSNGMSFWAFRDDLQRLNQVEQSNKQRAALAQTRAVM
LQASTALNKAGTLTALSYPADDIKTLMTTARASLTQSTTLFKSFMAMTAGNEHVRGLQKE
TEKSFARWHNDLEHQATWLESNQLSDFLTAPVQGSQNAFDVNFEAWQLEINHVLEAASAQ
SQRNYQISALVFISMIIVAAIYISSALWWTRKMIVQPLAIIGSHFDSIAAGNLARPIAVY
GRNEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQ
TAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDI
ISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIEES
VNRVQQGSKLVNNAAATMIDIVSSVTRVNDIIGEIASASEEQQRGIEQVAQAVSQMDQVT
QQNASLVEEAAVATEQLANQADHLSSRVAVFTLEEHEVARHESVQLQIAPVVS