Protein Info for ECD_01782 in Escherichia coli BL21

Annotation: aminodeoxychorismate synthase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 22 to 152 (131 residues), 97.7 bits, E=8e-32
• TIGR00553: aminodeoxychorismate synthase, component I
  • amino acids 107 to 446 (340 residues), 476.4 bits, E=2.3e-147
• PF00425: Chorismate_bind
  • amino acids 190 to 443 (254 residues), 301.6 bits, E=5.1e-94

Best Hits

Swiss-Prot: 98% identical to PABB_ECOLI: Aminodeoxychorismate synthase component 1 (pabB) from Escherichia coli (strain K12)

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 98% identity to eco:b1812)

MetaCyc: 98% identical to aminodeoxychorismate synthase subunit 1 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Protein Sequence (453 amino acids)

>ECD_01782 aminodeoxychorismate synthase, subunit I (Escherichia coli BL21)
MKTLSPAVITLPWRQDAAEFYFSRLSHLPWAMLLHSGYADHPYSRFDIVVADPICTLTTF
GKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQGGALGLFGYDLGRRFES
LPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVSLLSHNDVNARRAWLESQQFSPQEDFTL
TSDWQSNMTREQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQLNQANRAP
FSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQAEKLANSAKDR
AENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITARLPEQLHASDLLRA
AFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTSITIRTLTAINGQIY
CSAGGGIVADSQEEAEYQETFDKVNKILRQLEK