Protein Info for ECD_01760 in Escherichia coli BL21

Annotation: putative MFS transporter, inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 212 to 237 (26 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details TIGR00896: cyanate transporter" amino acids 15 to 368 (354 residues), 501 bits, see alignment E=9.4e-155 PF07690: MFS_1" amino acids 24 to 348 (325 residues), 84.9 bits, see alignment E=2.7e-28

Best Hits

Swiss-Prot: 100% identical to NIMT_ECOLI: 2-nitroimidazole transporter (nimT) from Escherichia coli (strain K12)

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 100% identity to eco:b1791)

MetaCyc: 100% identical to 2-nitroimidazole exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-273; TRANS-RXN0-596

Predicted SEED Role

"FIG00638318: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ECD_01760 putative MFS transporter, inner membrane protein (Escherichia coli BL21)
MTCSTSLSGKNRIVLIAGILMIATTLRVTFTGAAPLLDTIRSAYSLTTAQTGLLTTLPLL
AFALISPLAAPVARRFGMERSLFAALLLICAGIAIRSLPSPYLLFGGTAVIGGGIALGNV
LLPGLIKRDFPHSVARLTGAYSLTMGAAAALGSAMVVPLALNGFGWQGALLMLMCFPLLA
LFLWLPQWRSQQHANLSTSRALHTRGIWRSPLAWQVTLFLGINSLVYYVIIGWLPAILIS
HGYSEAQAGSLHGLLQLATAAPGLLIPLFLHHVKDQRGIAAFVALMCAVGAVGLCFMPAH
AITWTLLFGFGSGATMILGLTFIGLRASSAHQAAALSGMAQSVGYLLAACGPPLMGKIHD
ANGNWSVPLMGVAILSLLMAIFGLCAGRDKEIR