Protein Info for ECD_01639 in Escherichia coli BL21

Annotation: putative cytochrome b subunit of YdhYVWXUT oxidoreductase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 69 to 257 (189 residues), 110.7 bits, see alignment E=3.9e-36

Best Hits

Swiss-Prot: 100% identical to YDHU_ECOLI: Putative cytochrome YdhU (ydhU) from Escherichia coli (strain K12)

KEGG orthology group: K08354, thiosulfate reductase cytochrome b subunit (inferred from 100% identity to eco:b1670)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ECD_01639 putative cytochrome b subunit of YdhYVWXUT oxidoreductase complex (Escherichia coli BL21)
MNPSQHAEQFQSQLANYVPQFTPEFWPVWLIIAGVLLVGMWLVLGLHALLRARGVKKSAT
DHGEKIYLYSKAVRLWHWSNALLFVLLLASGLINHFAMVGATAVKSLVAVHEVCGFLLLA
CWLGFVLINAVGDNGHHYRIRRQGWLERAAKQTRFYLFGIMQGEEHPFPATTQSKFNPLQ
QVAYVGVMYGLLPLLLLTGLLCLYPQAVGDVFPGVRYWLLQTHFALAFISLFFIFGHLYL
CTTGRTPHETFKSMVDGYHRH