Protein Info for ECD_01566 in Escherichia coli BL21

Annotation: acid shock-inducible periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF06392: Asr" amino acids 22 to 102 (81 residues), 44.3 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 99% identical to ASR_ECO8A: Acid shock protein (asr) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: None (inferred from 97% identity to eco:b1597)

Predicted SEED Role

"Acid shock protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>ECD_01566 acid shock-inducible periplasmic protein (Escherichia coli BL21)
MKKVLALVVAAAMGLSSAAFAAETATTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQAA
KKHHKNAKAEQKAPEQKAQAAKKHAGKHSHQQPAKPAAQPAA