Protein Info for ECD_01472 in Escherichia coli BL21

Annotation: autoinducer 2 import system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 240 (233 residues), 137.4 bits, see alignment E=2.7e-44

Best Hits

KEGG orthology group: K10557, AI-2 transport system permease protein (inferred from 100% identity to ebr:ECB_01472)

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, membrane channel protein LsrD" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>ECD_01472 autoinducer 2 import system permease protein (Escherichia coli BL21)
MAESEPKAIALGVLFQSGVPMPLAILLTLLLGALCGLINAGLIIYTKVNPLVITLGTLYL
FAGSALLLSGMAGATGYEGIGGFPMAFTDFANLDVLGLPVPLIIFLICLLVFWLWLHKTH
AGRNVFLIGQSPRVALYSAIPVNRTLCALYAMTGLASAVAAVLLVSYFGSARSDLGASFL
MPAITAVVLGGANIYGGSGSIIGTAIAVLLVGYLQQGLQMAGVPNQVSSALSGALLIVVV
VGRSVSLHRQQIKEWLARRANNPLP