Protein Info for ECD_01434 in Escherichia coli BL21

Annotation: formate dehydrogenase-N, cytochrome B556 (gamma) subunit, nitrate-inducible

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 7 to 206 (200 residues), 230.3 bits, see alignment E=1.1e-72 PF01292: Ni_hydr_CYTB" amino acids 15 to 186 (172 residues), 81 bits, see alignment E=5e-27

Best Hits

Swiss-Prot: 100% identical to FDNI_ECO57: Formate dehydrogenase, nitrate-inducible, cytochrome b556(Fdn) subunit (fdnI) from Escherichia coli O157:H7

KEGG orthology group: K08350, formate dehydrogenase-N, gamma subunit [EC: 1.2.1.2] (inferred from 100% identity to eco:b1476)

MetaCyc: 100% identical to formate dehydrogenase N subunit gamma (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase N gamma subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ECD_01434 formate dehydrogenase-N, cytochrome B556 (gamma) subunit, nitrate-inducible (Escherichia coli BL21)
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI