Protein Info for ECD_01409 in Escherichia coli BL21

Annotation: ATP-binding protein, periplasmic, function unknown

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF21783: YNCE" amino acids 71 to 333 (263 residues), 42.3 bits, see alignment E=1.3e-14 PF13360: PQQ_2" amino acids 185 to 305 (121 residues), 23.8 bits, see alignment E=6.6e-09

Best Hits

Swiss-Prot: 99% identical to YNCE_ECO57: Uncharacterized protein YncE (yncE) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to ebw:BWG_1278)

Predicted SEED Role

"FIG00638561: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>ECD_01409 ATP-binding protein, periplasmic, function unknown (Escherichia coli BL21)
MHLRHLFSSRLRGSLLLGSLLVASSFSTQAAEEMLRKAVGKGAYEMAYSQQENALWLATS
QSRKLDKGGVVYRLDPVTLEVTQAIHNDLKPFGATINNTTQTLWFGNTVNSAVTAIDAKT
GEVKGRLVLDDRKRTEEVRPLQPRELVADDATNTVYISGIGKESVIWVVDGENIKLKTAI
QNTGKMSTGLALDSKGKRLYTTNADGELITIDTADNKILSRKKLLDDGKEHFFINISLDT
ARQRAFITDSKAAEVLVVDTRNGNILAKVAAPESLAVLFNPARNEAYVTHRQAGKVSVID
AKSYKVVKTFDTPTHPNSLALSADGKTLYVSVKQKSTKQQEATQPDDVIRIAL