Protein Info for ECD_01395 in Escherichia coli BL21

Annotation: antitoxin for the HicAB toxin-antitoxin system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF15970: HicB-like_2" amino acids 9 to 87 (79 residues), 67.1 bits, see alignment E=1.5e-22 PF15919: HicB_lk_antitox" amino acids 10 to 73 (64 residues), 30.7 bits, see alignment E=4.6e-11 PF01381: HTH_3" amino acids 95 to 141 (47 residues), 30.9 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 100% identical to HICB_ECO57: Antitoxin HicB (hicB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1438)

Predicted SEED Role

"FIG00638106: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>ECD_01395 antitoxin for the HicAB toxin-antitoxin system (Escherichia coli BL21)
MRGTVEIMRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFED
NELIPLPSPLNSHDHFIEVPLSVASKVLLLNAFLQSEITQQELARRIGKPKQEITRLFNL
HHATKIDAVQLAAKALGKELSLVMV