Protein Info for ECD_01345 in Escherichia coli BL21

Annotation: Rac prophage; putative site-specific recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00239: Resolvase" amino acids 5 to 144 (140 residues), 124.3 bits, see alignment E=4.3e-40 PF02796: HTH_7" amino acids 147 to 190 (44 residues), 42.2 bits, see alignment 6.9e-15

Best Hits

Swiss-Prot: 100% identical to PINQ_ECOLI: Serine recombinase PinQ (pinQ) from Escherichia coli (strain K12)

KEGG orthology group: K14060, putative DNA-invertase from lambdoid prophage Rac (inferred from 100% identity to eco:b1374)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>ECD_01345 Rac prophage; putative site-specific recombinase (Escherichia coli BL21)
MSQIFAYCRISTLDQTTENQRREIESAGFKIKPQQIIEEHISGSAATSERPGFNRLLARL
KCGDQLIVTKLDRLGCNAMDIRKTVEQLTETGIRVHCLALGGIDLTSPTGKMMMQVISAV
AEFERDLLLERTHSGIVRARGAGKRFGRPPVLNEEQKQVVFERIKSGVSISAIAREFKTS
RQTILRAKAKLQTPDI