Protein Info for ECD_01331 in Escherichia coli BL21

Annotation: phage superinfection exclusion protein, Rac prophage

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details PF14163: SieB" amino acids 21 to 160 (140 residues), 111 bits, see alignment E=1.9e-36

Best Hits

Swiss-Prot: 100% identical to SIEB_ECOLI: Superinfection exclusion protein B (sieB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1353)

Predicted SEED Role

"Superinfection exclusion protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>ECD_01331 phage superinfection exclusion protein, Rac prophage (Escherichia coli BL21)
MLDVFTPLLKLFANEPLERLMYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFS
FVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKK
LERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSRRFNR