Protein Info for ECD_01104 in Escherichia coli BL21

Annotation: putative UPF0227 family esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF05728: UPF0227" amino acids 1 to 177 (177 residues), 258.9 bits, see alignment E=1.5e-81

Best Hits

Swiss-Prot: 100% identical to YCFP_ECOLC: UPF0227 protein YcfP (ycfP) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K07000, (no description) (inferred from 99% identity to eco:b1108)

Predicted SEED Role

"YcfP protein: probably an esterase that is part of a salvage cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>ECD_01104 putative UPF0227 family esterase (Escherichia coli BL21)
MIIYLHGFDSNSPGNHEKVLQLQFIDPDVRLISYSTRHPKHDMQHLLKEVDKMLQLNVDE
RPLICGVGLGGYWAERIGFLCDIRQVIFNPNLFPYENMEGKIDRPEEYADIATKCVTNFR
EKNRDRCLVILSRNDEALNSQRTSEELHHYYEIVWDEEQSHKFKNISPHLQRIKAFKTLG