Protein Info for ECD_01075 in Escherichia coli BL21

Annotation: flagellar protein of basal-body outer-membrane L ring

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF02107: FlgH" amino acids 47 to 231 (185 residues), 208.1 bits, see alignment E=3.7e-66

Best Hits

Swiss-Prot: 100% identical to FLGH_SHISS: Flagellar L-ring protein (flgH) from Shigella sonnei (strain Ss046)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 100% identity to eco:b1079)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>ECD_01075 flagellar protein of basal-body outer-membrane L ring (Escherichia coli BL21)
MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPTPVANGSIFQSAQPINY
GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA
RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF
SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM