Protein Info for ECD_01019 in Escherichia coli BL21

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 223 to 236 (14 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details TIGR00145: FTR1 family protein" amino acids 3 to 276 (274 residues), 353 bits, see alignment E=7.4e-110 PF03239: FTR1" amino acids 4 to 278 (275 residues), 300.1 bits, see alignment E=8.4e-94

Best Hits

Swiss-Prot: 100% identical to EFEU_ECO57: Ferrous iron permease EfeU (efeU) from Escherichia coli O157:H7

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 99% identity to ecg:E2348C_1067)

Predicted SEED Role

"Ferrous iron transport permease EfeU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>ECD_01019 putative membrane protein (Escherichia coli BL21)
MGGMFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFIN
ETTGEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGW
ALVMMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNL
GAFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIF
GYQEAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA