Protein Info for ECD_00944 in Escherichia coli BL21

Annotation: putative outer membrane fimbrial subunit export usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 866 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF13954: PapC_N" amino acids 39 to 182 (144 residues), 164.8 bits, see alignment E=1.9e-52 PF00577: Usher" amino acids 201 to 777 (577 residues), 740.8 bits, see alignment E=1.8e-226 PF13953: PapC_C" amino acids 788 to 851 (64 residues), 63 bits, see alignment 2.9e-21

Best Hits

Swiss-Prot: 100% identical to ELFC_ECOLI: Probable outer membrane usher protein ElfC (elfC) from Escherichia coli (strain K12)

KEGG orthology group: K07347, outer membrane usher protein (inferred from 100% identity to eco:b0940)

Predicted SEED Role

"type 1 fimbriae anchoring protein FimD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (866 amino acids)

>ECD_00944 putative outer membrane fimbrial subunit export usher protein (Escherichia coli BL21)
MYRTHRQHSLLSSGGVPSFIGGLVVFVSAAFNAQAETWFDPAFFKDDPSMVADLSRFEKG
QKITPGGYRVDIVLNQTIVDTRNVNFVEITPEKGIAACLTTESLDAMGVNTDAFPAFKQL
DKQACVPLAEIIPDASVTFNVNKLRLEISVPQIAIKSNARGYVPPERWDEGINALLLGYS
FSGANSIHSSADSDSGDSYFLNLNSGVNLGPWRLRNNSTWSRSSGQTAEWKNLSSYLQRA
VIPLKGELTVGDDYTAGDFFDSVSFRGVQLASDDNMLPDSLKGFAPVVRGIAKSNAQITI
KQNGYTIYQTYVSPGAFEISDLYSTSSSGDLLVEIKEADGSVNSYSVPFSSVPLLQRQGR
IKYAVTLAKYRTNSNEQQESKFAQATLQWGGPWGTTWYGGGQYAEYYRAAMFGLGFNFGD
FGAISFDATQAKSTLADQSEHKGQSYRFLYAKTLNHLGTNFQLMGYRYSTSGFYTLSDTM
YKHMDGYEFNDGDDEDTPMWSRYYNLFYTKRGKLQVNISQQLGEYGSFYLSGSQQTYWHT
DQQDRLLQFGYNTQIKDLSLGISWNYSKSRGQPDADQVFALNFSLPLNLLLPRSNDSYTR
KKNYAWMTSNTSIDNEGHTTQNLGLTETLLDDGNLSYSVQQGYNSEGKTANGSASMDYKG
AFADARVGYNYSDNGSQQQLNYALSGSLVAHSQGITLGQSLGETNVLIAAPGAENTRVAN
STGLKTDWRGYTVVPYATSYRENRIALDAASLKRNVDLENAVVNVVPTKGALVLAEFNAH
AGARVLMKTSKQGIPLRFGAIATLDGVQANSGIIDDDGSLYMAGLPAKGTISVRWGEAPD
QICHINYELTEQQINSAITRMDAICR