Protein Info for ECD_00940 in Escherichia coli BL21

Annotation: aliphatic sulfonate ABC transporter periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 29 to 309 (281 residues), 287.7 bits, see alignment E=4.7e-90 PF04069: OpuAC" amino acids 29 to 245 (217 residues), 34.7 bits, see alignment E=3e-12 PF13379: NMT1_2" amino acids 57 to 236 (180 residues), 35.4 bits, see alignment E=2.2e-12 PF09084: NMT1" amino acids 68 to 182 (115 residues), 45.8 bits, see alignment E=1.5e-15 PF12974: Phosphonate-bd" amino acids 68 to 200 (133 residues), 39.8 bits, see alignment E=6.9e-14

Best Hits

Swiss-Prot: 99% identical to SSUA_ECOLI: Putative aliphatic sulfonates-binding protein (ssuA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 99% identity to eco:b0936)

MetaCyc: 99% identical to aliphatic sulfonate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>ECD_00940 aliphatic sulfonate ABC transporter periplasmic binding protein (Escherichia coli BL21)
MRNIIKLALVGLLSVSTIAVAAESSPEALRIGYQKGSIGMVLAKSHQLLEKRYPQSKISW
VEFPAGPQMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSP
IKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAW
AIWDPYYSAALLQGGVRVLKDGTDLNQTGSFYLAARPYAEKNGAFIQGVLATFSEADALT
RSQREQSIALLAKTMGLPAPVIASYLDHRPPTTIKPVNAEVAALQQQTADLFYENRLVPK
KVDIRQRIWQPTQLEGKQL