Protein Info for ECD_00925 in Escherichia coli BL21

Annotation: putative S-adenosyl-L-methionine-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF01209: Ubie_methyltran" amino acids 27 to 148 (122 residues), 41.1 bits, see alignment E=6.1e-14 PF13489: Methyltransf_23" amino acids 33 to 160 (128 residues), 60.3 bits, see alignment E=8.6e-20 PF05175: MTS" amino acids 44 to 148 (105 residues), 25 bits, see alignment E=5.8e-09 PF13847: Methyltransf_31" amino acids 45 to 193 (149 residues), 68.6 bits, see alignment E=2.4e-22 PF09445: Methyltransf_15" amino acids 47 to 112 (66 residues), 26.6 bits, see alignment E=1.9e-09 PF13649: Methyltransf_25" amino acids 48 to 143 (96 residues), 66.6 bits, see alignment E=1.2e-21 PF08242: Methyltransf_12" amino acids 49 to 145 (97 residues), 61.6 bits, see alignment E=4.4e-20 PF08241: Methyltransf_11" amino acids 49 to 146 (98 residues), 67.8 bits, see alignment E=5e-22

Best Hits

Swiss-Prot: 100% identical to CMOM_ECOLI: tRNA 5-carboxymethoxyuridine methyltransferase (cmoM) from Escherichia coli (strain K12)

KEGG orthology group: K06219, S-adenosylmethionine-dependent methyltransferase (inferred from 100% identity to eco:b0921)

MetaCyc: 100% identical to tRNA cmo5U34 methyltransferase (Escherichia coli K-12 substr. MG1655)
2.1.1.M28 [EC: 2.1.1.M28]

Predicted SEED Role

"S-adenosylmethionine-dependent methyltransferase Functionally Coupled to the MukBEF Chromosome Partitioning Mechanism" in subsystem MukBEF Chromosome Condensation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.M28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ECD_00925 putative S-adenosyl-L-methionine-dependent methyltransferase (Escherichia coli BL21)
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAI
KMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHA
VLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMPKKKKRTL
SPDYPRDPAQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEP
YITLGRYIHVTARKPQSKDKV