Protein Info for ECD_00895 in Escherichia coli BL21

Annotation: lipoprotein chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 1 to 203 (203 residues), 409.3 bits, see alignment E=1.2e-127 PF03548: LolA" amino acids 33 to 191 (159 residues), 204.7 bits, see alignment E=4.2e-65

Best Hits

Swiss-Prot: 100% identical to LOLA_ECO5E: Outer-membrane lipoprotein carrier protein (lolA) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 100% identity to eco:b0891)

MetaCyc: 100% identical to outer membrane lipoprotein carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>ECD_00895 lipoprotein chaperone (Escherichia coli BL21)
MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDL
WVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSS
DWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQN
GAVDAAKFTFTPPQGVTVDDQRK